Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)

Artikelnummer: CSB-MP339194ENV
Artikelname: Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)
Artikelnummer: CSB-MP339194ENV
Hersteller Artikelnummer: CSB-MP339194ENV
Alternativnummer: CSB-MP339194ENV-1, CSB-MP339194ENV-100, CSB-MP339194ENV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Alpha,alpha-trehalose-phosphate synthase [UDP-forming],Osmoregulatory trehalose synthesis protein A,UDP-glucose-glucosephosphate glucosyltransferase
Molekulargewicht: 59.7 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P31677
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 2-474aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNEDQPLKKVKKGNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLLPLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAAGPLPPKLAQLKAELKNVQ
Anwendungsbeschreibung: Research Areas: Others