Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)

Catalog Number: CSB-MP339194ENV
Article Name: Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)
Biozol Catalog Number: CSB-MP339194ENV
Supplier Catalog Number: CSB-MP339194ENV
Alternative Catalog Number: CSB-MP339194ENV-1, CSB-MP339194ENV-100, CSB-MP339194ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Alpha,alpha-trehalose-phosphate synthase [UDP-forming],Osmoregulatory trehalose synthesis protein A,UDP-glucose-glucosephosphate glucosyltransferase
Molecular Weight: 59.7 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P31677
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 2-474aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNEDQPLKKVKKGNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLLPLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAAGPLPPKLAQLKAELKNVQ
Application Notes: Research Areas: Others