Recombinant Macaca fascicularis Angiotensin-converting enzyme (ACE2), partial (Active)

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis Angiotensin-converting enzyme (ACE2), partial (Active)
• Artikelnummer: CSB-MP3414MOV
• Hersteller Artikelnummer: CSB-MP3414MOV
• Alternativnummer: CSB-MP3414MOV-1, CSB-MP3414MOV-100, CSB-MP3414MOV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 112.7 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: A0A2K5X283
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Mammalian cell
• Expression System: 18-741aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGNYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMWG

Bilder

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (CSB-MP3324GMY1b1) at 5 µg/ml can bind Cynomolgus-ACE2, the EC50 is 5.638-9.496 ng/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.