Recombinant Macaca fascicularis Angiotensin-converting enzyme (ACE2), partial (Active)

Product Overview

• Article Name: Recombinant Macaca fascicularis Angiotensin-converting enzyme (ACE2), partial (Active)
• Biozol Catalog Number: CSB-MP3414MOV
• Supplier Catalog Number: CSB-MP3414MOV
• Alternative Catalog Number: CSB-MP3414MOV-1, CSB-MP3414MOV-100, CSB-MP3414MOV-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide

Product Properties

• Molecular Weight: 112.7 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: A0A2K5X283
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Mammalian cell
• Expression System: 18-741aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGNYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMWG

Images

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (CSB-MP3324GMY1b1) at 5 µg/ml can bind Cynomolgus-ACE2, the EC50 is 5.638-9.496 ng/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.