Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial

Artikelnummer: CSB-MP4804HUH8
Artikelname: Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial
Artikelnummer: CSB-MP4804HUH8
Hersteller Artikelnummer: CSB-MP4804HUh8
Alternativnummer: CSB-MP4804HUH8-1, CSB-MP4804HUH8-100, CSB-MP4804HUH8-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 55.0 kDa
Tag: C-terminal mFc2a-tagged
UniProt: A8MVZ5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.34.
Quelle: Mammalian cell
Expression System: 27-254aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA
Anwendungsbeschreibung: Research Areas: Immunology