Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial

Catalog Number: CSB-MP4804HUH8
Article Name: Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial
Biozol Catalog Number: CSB-MP4804HUH8
Supplier Catalog Number: CSB-MP4804HUh8
Alternative Catalog Number: CSB-MP4804HUH8-1, CSB-MP4804HUH8-100, CSB-MP4804HUH8-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 55.0 kDa
Tag: C-terminal mFc2a-tagged
UniProt: A8MVZ5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.34.
Source: Mammalian cell
Expression System: 27-254aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA
Application Notes: Research Areas: Immunology