Recombinant Human IL27B&IL27A Heterodimer Protein

Artikelnummer: CSB-MP5979HU
Artikelname: Recombinant Human IL27B&IL27A Heterodimer Protein
Artikelnummer: CSB-MP5979HU
Hersteller Artikelnummer: CSB-MP5979HU
Alternativnummer: CSB-MP5979HU-1, CSB-MP5979HU-100, CSB-MP5979HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 49.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q14213
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 21-229aa(IL27B)&29-243aa(IL27A)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQ
Anwendungsbeschreibung: Research Areas: Others. Endotoxin: Not test