Recombinant Human IL27B&IL27A Heterodimer Protein

Catalog Number: CSB-MP5979HU
Article Name: Recombinant Human IL27B&IL27A Heterodimer Protein
Biozol Catalog Number: CSB-MP5979HU
Supplier Catalog Number: CSB-MP5979HU
Alternative Catalog Number: CSB-MP5979HU-1, CSB-MP5979HU-100, CSB-MP5979HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 49.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q14213
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 21-229aa(IL27B)&29-243aa(IL27A)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQ
Application Notes: Research Areas: Others. Endotoxin: Not test