Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Artikelnummer: CSB-MP620956HUB0
Artikelname: Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)
Artikelnummer: CSB-MP620956HUB0
Hersteller Artikelnummer: CSB-MP620956HUb0
Alternativnummer: CSB-MP620956HUB0-1, CSB-MP620956HUB0-100, CSB-MP620956HUB0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: IGFBP-rP1,MAC25 protein,PGI2-stimulating factor,Prostacyclin-stimulating factor,Tumor-derived adhesion factor
Molekulargewicht: 29.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q16270
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.63.
Quelle: Mammalian cell
Expression System: 27-282aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAE
Anwendungsbeschreibung: Research Areas: Cancer