Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Catalog Number: CSB-MP620956HUB0
Article Name: Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)
Biozol Catalog Number: CSB-MP620956HUB0
Supplier Catalog Number: CSB-MP620956HUb0
Alternative Catalog Number: CSB-MP620956HUB0-1, CSB-MP620956HUB0-100, CSB-MP620956HUB0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: IGFBP-rP1,MAC25 protein,PGI2-stimulating factor,Prostacyclin-stimulating factor,Tumor-derived adhesion factor
Molecular Weight: 29.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q16270
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.63.
Source: Mammalian cell
Expression System: 27-282aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAE
Application Notes: Research Areas: Cancer