Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)

Produktübersicht

• Artikelname: Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)
• Artikelnummer: CSB-MP673458HU
• Hersteller Artikelnummer: CSB-MP673458HU
• Alternativnummer: CSB-MP673458HU-1, CSB-MP673458HU-100, CSB-MP673458HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: KCASH2 protein,Potassium channel tetramerization domain-containing protein 21

Produkteigenschaften

• Molekulargewicht: 57.1 kDa
• Tag: N-terminal hFc1-tagged and C-terminal 10xHis-tagged
• UniProt: Q4G0X4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.64.
• Quelle: Mammalian cell
• Expression System: 1-260aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Research Areas: Cell Biology