Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)

Catalog Number: CSB-MP673458HU
Article Name: Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)
Biozol Catalog Number: CSB-MP673458HU
Supplier Catalog Number: CSB-MP673458HU
Alternative Catalog Number: CSB-MP673458HU-1, CSB-MP673458HU-100, CSB-MP673458HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: KCASH2 protein,Potassium channel tetramerization domain-containing protein 21
Molecular Weight: 57.1 kDa
Tag: N-terminal hFc1-tagged and C-terminal 10xHis-tagged
UniProt: Q4G0X4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.64.
Source: Mammalian cell
Expression System: 1-260aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIR
Application Notes: Research Areas: Cell Biology