Recombinant Paguma larvata Angiotensin-converting enzyme 2 (ACE2), partial (Active)

Produktübersicht

• Artikelname: Recombinant Paguma larvata Angiotensin-converting enzyme 2 (ACE2), partial (Active)
• Artikelnummer: CSB-MP684964PAL
• Hersteller Artikelnummer: CSB-MP684964PAL
• Alternativnummer: CSB-MP684964PAL-1, CSB-MP684964PAL-100, CSB-MP684964PAL-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 112.7 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: Q56NL1
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Mammalian cell
• Expression System: 18-740aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAKNMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTILNAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHLHAYVRAKLMDTYPSRISRTGCLPAHLLGDMWG

Bilder

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD (CSB-MP348663HQE) at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.②Recombinant Paguma larvata ACE2 protein (CSB-MP684964PAL) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Mca-Ala-Pro-Lys(Dnp)-OH), The Km is 22.84 µM.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.