Recombinant Paguma larvata Angiotensin-converting enzyme 2 (ACE2), partial (Active)

Product Overview

• Article Name: Recombinant Paguma larvata Angiotensin-converting enzyme 2 (ACE2), partial (Active)
• Biozol Catalog Number: CSB-MP684964PAL
• Supplier Catalog Number: CSB-MP684964PAL
• Alternative Catalog Number: CSB-MP684964PAL-1, CSB-MP684964PAL-100, CSB-MP684964PAL-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide

Product Properties

• Molecular Weight: 112.7 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: Q56NL1
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Mammalian cell
• Expression System: 18-740aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAKNMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTILNAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHLHAYVRAKLMDTYPSRISRTGCLPAHLLGDMWG

Images

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD (CSB-MP348663HQE) at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.②Recombinant Paguma larvata ACE2 protein (CSB-MP684964PAL) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Mca-Ala-Pro-Lys(Dnp)-OH), The Km is 22.84 µM.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.