Recombinant Rat V-set domain-containing T-cell activation inhibitor 1 (Vtcn1)

Artikelnummer: CSB-MP700510RA
Artikelname: Recombinant Rat V-set domain-containing T-cell activation inhibitor 1 (Vtcn1)
Artikelnummer: CSB-MP700510RA
Hersteller Artikelnummer: CSB-MP700510RA
Alternativnummer: CSB-MP700510RA-1, CSB-MP700510RA-100, CSB-MP700510RA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Vtcn1
Molekulargewicht: 27.0 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q501W4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 25-257aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG
Anwendungsbeschreibung: Research Areas: Cancer. Endotoxin: Not test