Recombinant Rat V-set domain-containing T-cell activation inhibitor 1 (Vtcn1)

Catalog Number: CSB-MP700510RA
Article Name: Recombinant Rat V-set domain-containing T-cell activation inhibitor 1 (Vtcn1)
Biozol Catalog Number: CSB-MP700510RA
Supplier Catalog Number: CSB-MP700510RA
Alternative Catalog Number: CSB-MP700510RA-1, CSB-MP700510RA-100, CSB-MP700510RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Vtcn1
Molecular Weight: 27.0 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q501W4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 25-257aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG
Application Notes: Research Areas: Cancer. Endotoxin: Not test