Recombinant Human Lysophospholipase D GDPD3 (GDPD3)

Artikelnummer: CSB-MP759171HU
Artikelname: Recombinant Human Lysophospholipase D GDPD3 (GDPD3)
Artikelnummer: CSB-MP759171HU
Hersteller Artikelnummer: CSB-MP759171HU
Alternativnummer: CSB-MP759171HU-1, CSB-MP759171HU-100, CSB-MP759171HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Glycerophosphodiester phosphodiesterase 7,Glycerophosphodiester phosphodiesterase domain-containing protein 3
Molekulargewicht: 49.1 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q7L5L3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 24-198aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLS
Anwendungsbeschreibung: Research Areas: Signal Transduction