Recombinant Human Lysophospholipase D GDPD3 (GDPD3)

Catalog Number: CSB-MP759171HU
Article Name: Recombinant Human Lysophospholipase D GDPD3 (GDPD3)
Biozol Catalog Number: CSB-MP759171HU
Supplier Catalog Number: CSB-MP759171HU
Alternative Catalog Number: CSB-MP759171HU-1, CSB-MP759171HU-100, CSB-MP759171HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Glycerophosphodiester phosphodiesterase 7,Glycerophosphodiester phosphodiesterase domain-containing protein 3
Molecular Weight: 49.1 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q7L5L3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 24-198aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLS
Application Notes: Research Areas: Signal Transduction