Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3)

Artikelnummer: CSB-MP849681MOD9
Artikelname: Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3)
Artikelnummer: CSB-MP849681MOD9
Hersteller Artikelnummer: CSB-MP849681MOd9
Alternativnummer: CSB-MP849681MOD9-1, CSB-MP849681MOD9-100, CSB-MP849681MOD9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: GPI-anchored metastasis-associated protein C4.4A homolog
Molekulargewicht: 61.0 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q91YK8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.57.
Quelle: Mammalian cell
Expression System: 33-343aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH
Anwendungsbeschreibung: Research Areas: Cancer