Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3)

Catalog Number: CSB-MP849681MOD9
Article Name: Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3)
Biozol Catalog Number: CSB-MP849681MOD9
Supplier Catalog Number: CSB-MP849681MOd9
Alternative Catalog Number: CSB-MP849681MOD9-1, CSB-MP849681MOD9-100, CSB-MP849681MOD9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: GPI-anchored metastasis-associated protein C4.4A homolog
Molecular Weight: 61.0 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q91YK8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.57.
Source: Mammalian cell
Expression System: 33-343aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH
Application Notes: Research Areas: Cancer