Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial

Artikelnummer: CSB-MP866317HUB0
Artikelname: Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial
Artikelnummer: CSB-MP866317HUB0
Hersteller Artikelnummer: CSB-MP866317HUb0
Alternativnummer: CSB-MP866317HUB0-1, CSB-MP866317HUB0-100, CSB-MP866317HUB0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Angiotensin-converting enzyme homolog ,Angiotensin-converting enzyme-related carboxypeptidase
Molekulargewicht: 86.4 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q9BYF1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 18-740aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.