Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial

Catalog Number: CSB-MP866317HUB0
Article Name: Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial
Biozol Catalog Number: CSB-MP866317HUB0
Supplier Catalog Number: CSB-MP866317HUb0
Alternative Catalog Number: CSB-MP866317HUB0-1, CSB-MP866317HUB0-100, CSB-MP866317HUB0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Angiotensin-converting enzyme homolog ,Angiotensin-converting enzyme-related carboxypeptidase
Molecular Weight: 86.4 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q9BYF1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 18-740aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.