Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial

Artikelnummer: CSB-MP884629HUD7
Artikelname: Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial
Artikelnummer: CSB-MP884629HUD7
Hersteller Artikelnummer: CSB-MP884629HUd7
Alternativnummer: CSB-MP884629HUD7-1, CSB-MP884629HUD7-100, CSB-MP884629HUD7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Protein BSCv
Molekulargewicht: 41.6 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q9HDC9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 62-416aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.