Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial

Catalog Number: CSB-MP884629HUD7
Article Name: Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial
Biozol Catalog Number: CSB-MP884629HUD7
Supplier Catalog Number: CSB-MP884629HUd7
Alternative Catalog Number: CSB-MP884629HUD7-1, CSB-MP884629HUD7-100, CSB-MP884629HUD7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Protein BSCv
Molecular Weight: 41.6 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q9HDC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 62-416aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.