Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial

Produktübersicht

• Artikelname: Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial
• Artikelnummer: CSB-MP887907PI
• Hersteller Artikelnummer: CSB-MP887907PI
• Alternativnummer: CSB-MP887907PI-1, CSB-MP887907PI-100, CSB-MP887907PI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Killer cell lectin-like receptor subfamily K member 1,NK cell receptor D,NKG2-D-activating NK receptor,CD antigen CD314

Produkteigenschaften

• Molekulargewicht: 17.2 kDa
• Tag: N-terminal mFc-tagged
• UniProt: Q9GLF5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 78-214aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.