Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial

Catalog Number: CSB-MP887907PI
Article Name: Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial
Biozol Catalog Number: CSB-MP887907PI
Supplier Catalog Number: CSB-MP887907PI
Alternative Catalog Number: CSB-MP887907PI-1, CSB-MP887907PI-100, CSB-MP887907PI-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Killer cell lectin-like receptor subfamily K member 1,NK cell receptor D,NKG2-D-activating NK receptor,CD antigen CD314
Molecular Weight: 17.2 kDa
Tag: N-terminal mFc-tagged
UniProt: Q9GLF5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 78-214aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.