Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

Artikelnummer: CSB-MP887932AKE
Artikelname: Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595
Artikelnummer: CSB-MP887932AKE
Hersteller Artikelnummer: CSB-MP887932AKE
Alternativnummer: CSB-MP887932AKE-1, CSB-MP887932AKE-100, CSB-MP887932AKE-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: asFP595
Molekulargewicht: 35.7 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q9GZ28
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 1-62aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.