Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

Catalog Number: CSB-MP887932AKE
Article Name: Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595
Biozol Catalog Number: CSB-MP887932AKE
Supplier Catalog Number: CSB-MP887932AKE
Alternative Catalog Number: CSB-MP887932AKE-1, CSB-MP887932AKE-100, CSB-MP887932AKE-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: asFP595
Molecular Weight: 35.7 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q9GZ28
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-62aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.