Recombinant MouseAquaporin-4 (Aqp4), partial

Produktübersicht

• Artikelname: Recombinant MouseAquaporin-4 (Aqp4), partial
• Artikelnummer: CSB-YP001964MO1
• Hersteller Artikelnummer: CSB-YP001964MO1
• Alternativnummer: CSB-YP001964MO1-1, CSB-YP001964MO1-100, CSB-YP001964MO1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Mercurial-insensitive water channel

Produkteigenschaften

• Molekulargewicht: 9.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P55088
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 253-323aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV