Recombinant MouseAquaporin-4 (Aqp4), partial

Catalog Number: CSB-YP001964MO1
Article Name: Recombinant MouseAquaporin-4 (Aqp4), partial
Biozol Catalog Number: CSB-YP001964MO1
Supplier Catalog Number: CSB-YP001964MO1
Alternative Catalog Number: CSB-YP001964MO1-1, CSB-YP001964MO1-100, CSB-YP001964MO1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Mercurial-insensitive water channel
Molecular Weight: 9.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P55088
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 253-323aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV