Recombinant Mouse Aquaporin-4 (Aqp4), partial

Artikelnummer: CSB-YP001964MO1F3
Artikelname: Recombinant Mouse Aquaporin-4 (Aqp4), partial
Artikelnummer: CSB-YP001964MO1F3
Hersteller Artikelnummer: CSB-YP001964MO1f3
Alternativnummer: CSB-YP001964MO1F3-1, CSB-YP001964MO1F3-100, CSB-YP001964MO1F3-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Mercurial-insensitive water channel
Molekulargewicht: 10.9 kDa
Tag: C-terminal 6xHis-Myc-tagged
UniProt: P55088
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 253-323aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
The reducing (R) protein migrates as 16 kDa in SDS-PAGE may be due to glycosylation.