Recombinant Mouse Aquaporin-4 (Aqp4), partial

Catalog Number: CSB-YP001964MO1F3
Article Name: Recombinant Mouse Aquaporin-4 (Aqp4), partial
Biozol Catalog Number: CSB-YP001964MO1F3
Supplier Catalog Number: CSB-YP001964MO1f3
Alternative Catalog Number: CSB-YP001964MO1F3-1, CSB-YP001964MO1F3-100, CSB-YP001964MO1F3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Mercurial-insensitive water channel
Molecular Weight: 10.9 kDa
Tag: C-terminal 6xHis-Myc-tagged
UniProt: P55088
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 253-323aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
The reducing (R) protein migrates as 16 kDa in SDS-PAGE may be due to glycosylation.