Recombinant Mouse Aquaporin-7 (Aqp7), partial

Produktübersicht

• Artikelname: Recombinant Mouse Aquaporin-7 (Aqp7), partial
• Artikelnummer: CSB-YP001967MO1F5
• Hersteller Artikelnummer: CSB-YP001967MO1f5
• Alternativnummer: CSB-YP001967MO1F5-1,CSB-YP001967MO1F5-100,CSB-YP001967MO1F5-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: AQP-7,Aquaglyceroporin-7

Produkteigenschaften

• Molekulargewicht: 37.6 kDa
• Tag: C-terminal 6xHis-GFP-tagged
• UniProt: O54794
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 221-303aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF