Recombinant Mouse Aquaporin-7 (Aqp7), partial
Catalog Number:
CSB-YP001967MO1F5
- Images (0)
| Article Name: | Recombinant Mouse Aquaporin-7 (Aqp7), partial |
| Biozol Catalog Number: | CSB-YP001967MO1F5 |
| Supplier Catalog Number: | CSB-YP001967MO1f5 |
| Alternative Catalog Number: | CSB-YP001967MO1F5-1,CSB-YP001967MO1F5-100,CSB-YP001967MO1F5-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | AQP-7,Aquaglyceroporin-7 |
| Molecular Weight: | 37.6 kDa |
| Tag: | C-terminal 6xHis-GFP-tagged |
| UniProt: | O54794 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 221-303aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF |
Product Guarantee and Expert Support
