Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial

Artikelnummer: CSB-YP004435HU
Artikelname: Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial
Artikelnummer: CSB-YP004435HU
Hersteller Artikelnummer: CSB-YP004435HU
Alternativnummer: CSB-YP004435HU-1, CSB-YP004435HU-100, CSB-YP004435HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-type CGRP,Calcitonin gene-related peptide II
Molekulargewicht: 16.9 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P10092
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 82-118aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Anwendungsbeschreibung: Research Areas: Neuroscience