Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial

Catalog Number: CSB-YP004435HU
Article Name: Recombinant Human Calcitonin gene-related peptide 2 (CALCB), partial
Biozol Catalog Number: CSB-YP004435HU
Supplier Catalog Number: CSB-YP004435HU
Alternative Catalog Number: CSB-YP004435HU-1, CSB-YP004435HU-100, CSB-YP004435HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-type CGRP,Calcitonin gene-related peptide II
Molecular Weight: 16.9 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P10092
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 82-118aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Application Notes: Research Areas: Neuroscience