Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)

Artikelnummer: CSB-YP007800HUA4
Artikelname: Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)
Artikelnummer: CSB-YP007800HUA4
Hersteller Artikelnummer: CSB-YP007800HUa4
Alternativnummer: CSB-YP007800HUA4-1, CSB-YP007800HUA4-100, CSB-YP007800HUA4-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Endoplasmic reticulum resident protein 28,Endoplasmic reticulum resident protein 31
Molekulargewicht: 39.0 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P30040
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 33-261aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Anwendungsbeschreibung: Research Areas: Signal Transduction. Endotoxin: Not test