Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)

Catalog Number: CSB-YP007800HUA4
Article Name: Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)
Biozol Catalog Number: CSB-YP007800HUA4
Supplier Catalog Number: CSB-YP007800HUa4
Alternative Catalog Number: CSB-YP007800HUA4-1, CSB-YP007800HUA4-100, CSB-YP007800HUA4-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Endoplasmic reticulum resident protein 28,Endoplasmic reticulum resident protein 31
Molecular Weight: 39.0 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P30040
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 33-261aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Application Notes: Research Areas: Signal Transduction. Endotoxin: Not test