Recombinant Human Insulin (INS), partial
Artikelnummer:
CSB-YP011742HU-WD
- Bilder (0)
| Artikelname: | Recombinant Human Insulin (INS), partial |
| Artikelnummer: | CSB-YP011742HU-WD |
| Hersteller Artikelnummer: | CSB-YP011742HU-WD |
| Alternativnummer: | CSB-YP011742HU-WD-1, CSB-YP011742HU-WD-100 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Insulin, INS, IDDM, ILPR, IRDN, MODY10 |
| Molekulargewicht: | 5.8 kDa |
| Tag: | Tag free |
| UniProt: | P01308 |
| Puffer: | Lyophilized from a 0.2 µm filtered solution(It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.) |
| Quelle: | Yeast |
| Expression System: | 25-54aa&90-110aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Produktgarantie und fachkundiger Support
