Recombinant Human Insulin (INS), partial
Catalog Number:
CSB-YP011742HU-WD
- Images (0)
| Article Name: | Recombinant Human Insulin (INS), partial |
| Biozol Catalog Number: | CSB-YP011742HU-WD |
| Supplier Catalog Number: | CSB-YP011742HU-WD |
| Alternative Catalog Number: | CSB-YP011742HU-WD-1, CSB-YP011742HU-WD-100 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Insulin, INS, IDDM, ILPR, IRDN, MODY10 |
| Molecular Weight: | 5.8 kDa |
| Tag: | Tag free |
| UniProt: | P01308 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution(It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.) |
| Source: | Yeast |
| Expression System: | 25-54aa&90-110aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Product Guarantee and Expert Support
