Recombinant Enterobacteria phage M13 Attachment protein G3P (III)

Artikelnummer: CSB-YP303116ECY
Artikelname: Recombinant Enterobacteria phage M13 Attachment protein G3P (III)
Artikelnummer: CSB-YP303116ECY
Hersteller Artikelnummer: CSB-YP303116ECY
Alternativnummer: CSB-YP303116ECY-1, CSB-YP303116ECY-100, CSB-YP303116ECY-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Gene 3 protein Short name: G3P Minor coat protein
Molekulargewicht: 44.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P69168
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 19-424aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGS