Recombinant Enterobacteria phage M13 Attachment protein G3P (III)
Catalog Number:
CSB-YP303116ECY
- Images (0)
| Article Name: | Recombinant Enterobacteria phage M13 Attachment protein G3P (III) |
| Biozol Catalog Number: | CSB-YP303116ECY |
| Supplier Catalog Number: | CSB-YP303116ECY |
| Alternative Catalog Number: | CSB-YP303116ECY-1, CSB-YP303116ECY-100, CSB-YP303116ECY-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Gene 3 protein Short name: G3P Minor coat protein |
| Molecular Weight: | 44.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P69168 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 19-424aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGS |
Product Guarantee and Expert Support
