Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)

Produktübersicht

• Artikelname: Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)
• Artikelnummer: CSB-YP318939KBG
• Hersteller Artikelnummer: CSB-YP318939KBG
• Alternativnummer: CSB-YP318939KBG-1, CSB-YP318939KBG-100, CSB-YP318939KBG-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 31.6 kDa
• Tag: N-terminal 6xHis-sumostar-tagged
• UniProt: P12267
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 23-202aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ