Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)

Catalog Number: CSB-YP318939KBG
Article Name: Recombinant Klebsiella pneumoniae Fimbrial subunit type 3 (mrkA)
Biozol Catalog Number: CSB-YP318939KBG
Supplier Catalog Number: CSB-YP318939KBG
Alternative Catalog Number: CSB-YP318939KBG-1, CSB-YP318939KBG-100, CSB-YP318939KBG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 31.6 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P12267
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 23-202aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ