Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Artikelnummer: CSB-YP362480LNP2
Artikelname: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial
Artikelnummer: CSB-YP362480LNP2
Hersteller Artikelnummer: CSB-YP362480LNP2
Alternativnummer: CSB-YP362480LNP2-1, CSB-YP362480LNP2-100, CSB-YP362480LNP2-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Pre-GP-C,GPC,GP-C
Molekulargewicht: 24.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P08669
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 59-259aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
Anwendungsbeschreibung: Research Areas: Signal Transduction. Endotoxin: Not test