Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Catalog Number: CSB-YP362480LNP2
Article Name: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial
Biozol Catalog Number: CSB-YP362480LNP2
Supplier Catalog Number: CSB-YP362480LNP2
Alternative Catalog Number: CSB-YP362480LNP2-1, CSB-YP362480LNP2-100, CSB-YP362480LNP2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Pre-GP-C,GPC,GP-C
Molecular Weight: 24.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P08669
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 59-259aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
Application Notes: Research Areas: Signal Transduction. Endotoxin: Not test