Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial

Artikelnummer: CSB-YP3653CZD
Artikelname: Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial
Artikelnummer: CSB-YP3653CZD
Hersteller Artikelnummer: CSB-YP3653CZD
Alternativnummer: CSB-YP3653CZD-1, CSB-YP3653CZD-100, CSB-YP3653CZD-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Mannoprotein of 65 kDa,Soluble cell wall protein 10
Molekulargewicht: 9.4 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q59XX2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 47-125aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IGNGDQTTTFAAPSVAAESSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGGVGSGG
Anwendungsbeschreibung: Research Areas: Signal Transduction. Endotoxin: Not test