Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial

Catalog Number: CSB-YP3653CZD
Article Name: Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial
Biozol Catalog Number: CSB-YP3653CZD
Supplier Catalog Number: CSB-YP3653CZD
Alternative Catalog Number: CSB-YP3653CZD-1, CSB-YP3653CZD-100, CSB-YP3653CZD-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Mannoprotein of 65 kDa,Soluble cell wall protein 10
Molecular Weight: 9.4 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q59XX2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 47-125aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IGNGDQTTTFAAPSVAAESSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGGVGSGG
Application Notes: Research Areas: Signal Transduction. Endotoxin: Not test