Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial

Artikelnummer: CSB-YP4727MOV
Artikelname: Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial
Artikelnummer: CSB-YP4727MOV
Hersteller Artikelnummer: CSB-YP4727MOV
Alternativnummer: CSB-YP4727MOV-1, CSB-YP4727MOV-100, CSB-YP4727MOV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 18.3 kDa
Tag: C-terminal 10xHis-tagged
UniProt: G7Q0A1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 23-169aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.