Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial
Catalog Number:
CSB-YP4727MOV
- Images (0)
| Article Name: | Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial |
| Biozol Catalog Number: | CSB-YP4727MOV |
| Supplier Catalog Number: | CSB-YP4727MOV |
| Alternative Catalog Number: | CSB-YP4727MOV-1, CSB-YP4727MOV-100, CSB-YP4727MOV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 18.3 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | G7Q0A1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-169aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT |
Product Guarantee and Expert Support
